CookSnap is coming soon — Join the waitlist →
Back to recipes

Korean Ground Beef Bowl

Seasoned ground beef over rice with a soy-ginger glaze, topped with a runny egg and crispy breadcrumbs. Restaurant-quality in under 25 minutes.

Total time
25 min
Servings
2
Calories
625
Protein
32g
Korean Ground Beef Bowl
comfortsatisfyingkoreanbeefcrispytendercreamyweeknight

Ingredients

  • 1 cup short-grain white rice
  • ¾ lb ground beef
  • 3 tbsp soy sauce
  • 1 tbsp ginger, minced
  • 2 cloves garlic, minced
  • 1 tbsp brown sugar
  • 1 tsp sesame oil
  • 2 whole eggs
  • ¼ cup panko breadcrumbs
  • 2 whole scallions, sliced

Instructions

  1. 1

    Boil rice in salted water according to package directions, about 15 minutes. Keep warm.

  2. 2

    Whisk together soy sauce, ginger, garlic, brown sugar, and sesame oil in a small bowl.

  3. 3

    Toast panko in a dry skillet over medium-high heat, stirring, until light golden, 2–3 minutes.

  4. 4

    Add 1 tbsp oil to the same skillet over medium-high. Cook ground beef, breaking apart with a spoon, until no pink remains, 5–6 minutes.

  5. 5

    Pour sauce over beef and stir until everything is glossy and caramelized, about 1 minute.

  6. 6

    Push beef to the side of the skillet. Crack eggs into the open space and cook until whites set but yolks still jiggle, 3–4 minutes.

  7. 7

    Divide rice between two bowls. Top each with half the beef and one egg.

  8. 8

    Sprinkle toasted panko and scallions over the top. Serve immediately.

Tools you’ll need

  • medium saucepan with lid
  • 12-inch skillet
  • small mixing bowl
  • whisk
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.