CookSnap is coming soon — Join the waitlist →
Back to recipes

Korean Chicken Stir-Fry (Dak Bal)

Tender chicken and crisp vegetables tossed in a savory-sweet soy glaze with sesame and ginger. A weeknight favorite that comes together in one pan in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
42g
Korean Chicken Stir-Fry (Dak Bal)
quicksatisfyingkoreanchickentendercrispyweeknightstir-fry

Ingredients

  • 1 lb chicken thighs, boneless and skinless
  • 3 tablespoons soy sauce
  • 1 tablespoon minced ginger, fresh
  • 2 cloves garlic, minced
  • 1 tablespoon sesame oil
  • 2 whole green onions

Instructions

  1. 1

    Pat the chicken thighs dry with paper towels, then cut each thigh into 2-inch chunks by cutting crosswise against the grain, so pieces are tender when cooked.

  2. 2

    Mince the ginger until pieces are smaller than a grain of rice—about pencil-tip size. Mince the garlic the same way. Cut the green onions crosswise into 1-inch pieces.

  3. 3

    Heat 1 tablespoon olive oil in a 12-inch skillet over medium-high heat until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  4. 4

    Add the chicken chunks in a single layer and cook without stirring until the bottom is light golden, about 3 minutes, then stir and cook another 2 minutes.

  5. 5

    Push the chicken to the edges of the pan, pour the minced ginger and garlic into the center, and stir for 30 seconds until you smell them strongly fragrant.

  6. 6

    Pour in the soy sauce and 2 tablespoons water, then stir everything together and cook for 2 minutes, tossing occasionally, until the liquid coats the chicken.

  7. 7

    Drizzle the sesame oil over the pan and toss to coat, then transfer to a serving bowl.

  8. 8

    Scatter the green onion pieces on top of the chicken.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife
  • paper towels
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.