CookSnap is coming soon — Join the waitlist →

Lyodur Tschaman — Kashmiri Paneer with Rice & Naan

Tender paneer in a silky turmeric-yogurt sauce, the heart of this Kashmiri classic. Serve with jeera rice, naan, and fresh garnishes for a complete weeknight dinner.

Total time
25 min
Servings
2
Calories
420
Protein
18g
Lyodur Tschaman — Kashmiri Paneer with Rice & Naan
comfortwholesomeindianvegetarianpaneercreamytenderweeknight

Ingredients

  • 14 oz paneer, cubed
  • ¾ cup plain yogurt
  • 1.5 tsp turmeric powder
  • 1 tbsp ginger-garlic paste
  • 2 whole green chilies, sliced
  • 2 whole naan (store-bought)
  • 1.5 cup cooked jeera rice
  • 1 serving red onion & tomato slices, plus lime wedges

Instructions

  1. 1

    Heat 2 tbsp oil in a skillet over medium. Add ginger-garlic paste and sliced green chilies, sauté 60 seconds until fragrant.

  2. 2

    Stir in yogurt and turmeric powder until smooth. Bring to a gentle simmer, stirring occasionally, for 2 minutes.

  3. 3

    Add paneer cubes to the sauce. Simmer gently for 8 minutes without stirring aggressively—paneer will soften and sauce will coat.

  4. 4

    Season with salt and pepper to taste. Warm naan in a dry skillet or over a flame until pliable, about 90 seconds per side.

  5. 5

    Divide jeera rice and paneer curry between two plates. Serve with warm naan, sliced onions, tomato slices, and lime wedges on the side.

Tools you’ll need

  • 10-inch skillet
  • wooden spoon
  • serving plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.