Käsekuchen Skillet
German cheese cake meets dinner: a custardy, golden skillet bake with quark, eggs, and a buttery crust, ready in 20 minutes. Tangy, rich, and surprisingly savory.
- Total time
- 22 min
- Servings
- 4
- Calories
- 285
- Protein
- 14g
comfortsimplegermanvegetarianeggscheesecreamyfluffy
Ingredients
- 3 tbsp butter
- 500 g quark (or ricotta + sour cream blend)
- 4 whole eggs
- 3 tbsp granulated sugar
- 1 tsp lemon zest
- 2 tbsp cornstarch
Instructions
- 1
Preheat oven to 375°F (190°C). Rub a 10-inch cast-iron skillet with 1 tbsp butter.
- 2
Whisk eggs with sugar and lemon zest until pale and thick, about 2 minutes.
- 3
Fold quark and cornstarch into eggs until just combined—don't overmix.
- 4
Pour mixture into the buttered skillet. Dot the top with remaining 2 tbsp butter.
- 5
Bake until the top is golden brown and the center jiggles only slightly, 12–14 minutes.
- 6
Let rest 2 minutes. Serve warm, cut into wedges.
Tools you’ll need
- 10-inch cast-iron skillet or 9x9-inch baking dish
- mixing bowl
- whisk
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
