CookSnap is coming soon — Join the waitlist →
Back to recipes

Karaage Chicken with Rice, Slaw & Potato Salad

Crispy Japanese fried chicken bites served alongside steamed rice, fresh cabbage slaw, and creamy potato salad. A complete weeknight dinner ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
625
Protein
38g
Karaage Chicken with Rice, Slaw & Potato Salad
satisfyingcasualjapanesechickencrispytendercreamyweeknight

Ingredients

  • 1 lb boneless, skinless chicken thighs
  • ½ cup all-purpose flour
  • 3 tbsp soy sauce
  • 2 tbsp rice vinegar
  • 1 tbsp fresh ginger, minced
  • 2 cups cooked white rice
  • 3 cups shredded cabbage
  • 1 cup prepared potato salad or cooked potatoes with mayo

Instructions

  1. 1

    Cut chicken into 1.5-inch bite-sized pieces and pat dry with paper towels.

  2. 2

    Combine soy sauce, vinegar, ginger, salt, and pepper in a bowl; toss chicken to coat evenly, 2 minutes.

  3. 3

    Dust chicken with flour, shaking off excess until all pieces are lightly coated.

  4. 4

    Heat 0.5 inch neutral oil in a 12-inch skillet over medium-high until it shimmers, about 2 minutes.

  5. 5

    Working in batches, fry chicken 3–4 minutes per side until deep golden brown and cooked through.

  6. 6

    Toss shredded cabbage with a splash of rice vinegar and pinch of salt for the slaw.

  7. 7

    Arrange karaage, warm rice, slaw, and potato salad on plates. Serve hot.

Tools you’ll need

  • 12-inch skillet or wok
  • paper towels
  • medium mixing bowl
  • shallow bowl or plate
  • tongs or slotted spoon
  • instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.