CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Ikan Bakar with Sambal & Sides

Whole grilled fish brushed with spiced sambal, cooked alongside crispy tofu and tempeh on one sheet pan. Serve with steamed rice, fresh cucumbers, and extra sambal for a complete Indonesian dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
38g
Sheet-Pan Ikan Bakar with Sambal & Sides
comfortfreshindonesianfishcrispytenderweeknightdinner

Ingredients

  • 2 fish (8-10 oz each) whole fish (mackerel, snapper, or sea bass), cleaned and gutted
  • 3 tbsp sambal paste (store-bought)
  • 1 lime, juiced lime juice
  • 1 block (14 oz) firm tofu, pressed and cubed
  • 6 oz tempeh, sliced into strips
  • 3 tbsp neutral cooking oil
  • 1 cucumber cucumber, sliced into thin rounds

Instructions

  1. 1

    Pat fish dry inside and out with paper towels. Score the skin 3 times on each side.

  2. 2

    Mix sambal with lime juice and 1 tbsp oil. Brush generously inside and outside the fish.

  3. 3

    Arrange fish, tofu cubes, and tempeh strips on a sheet pan. Drizzle remaining oil over tofu and tempeh. Season with salt and pepper.

  4. 4

    Broil 6 inches from heat for 12–14 minutes until fish skin crisps and flesh flakes easily at the thickest part.

  5. 5

    Divide rice among plates. Top with fish, tofu, tempeh, and cucumber slices.

  6. 6

    Serve with extra sambal and lime wedges on the side.

Tools you’ll need

  • sheet pan (18×13 inch)
  • oven broiler
  • paper towels
  • knife
  • small bowl
  • kitchen tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.