CookSnap is coming soon — Join the waitlist →

Hungarian Paprikás Krumpli

Tender potatoes and onions braised in a rich paprika sauce, finished with sour cream. A warming Hungarian classic that tastes like comfort in a bowl.

Total time
25 min
Servings
4
Calories
285
Protein
6g
Hungarian Paprikás Krumpli
comfortwholesomehungarianvegetarianvegetariantendercreamyweeknight

Ingredients

  • 1.5 lbs potatoes, waxy varieties like Yukon Gold
  • 1 whole yellow onion, large
  • 2 tablespoons paprika, Hungarian sweet
  • 3 tablespoons olive oil
  • 1.5 cups vegetable broth
  • ½ cup sour cream

Instructions

  1. 1

    Cut the potatoes into 1-inch cubes by first cutting them lengthwise into thin slabs, then into sticks, then crosswise into cubes about the size of dice. Place the cut potatoes in a bowl of cold water.

  2. 2

    Cut the onion in half from root to tip, then place each half flat-side down. Slice each half crosswise into thin half-moon pieces, about 1/4-inch thick.

  3. 3

    Heat the olive oil in a large heavy-bottomed pot or deep skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 1 minute.

  4. 4

    Add the sliced onions to the hot oil and stir with a wooden spoon every 20 seconds until the onions turn soft and golden, about 3 minutes.

  5. 5

    Stir the paprika into the onions for 30 seconds until it becomes very fragrant and coats all the onion pieces, so it doesn't scorch.

  6. 6

    Drain the potatoes in a colander and add them to the pot, stirring once to mix with the paprika and onions.

  7. 7

    Pour in the vegetable broth—the liquid should cover the potatoes by about 1 inch. Stir once, then bring to a boil over medium-high heat.

  8. 8

    Once the broth boils vigorously, reduce heat to medium-low and cover with a lid. Simmer undisturbed for 12–15 minutes until the potatoes are easily pierced with a fork but still hold their shape.

  9. 9

    Remove the pot from the heat and stir in the sour cream until it is fully blended and no white streaks remain, about 20 seconds.

Tools you’ll need

  • cutting board
  • large chef's knife
  • colander
  • large heavy-bottomed pot or deep skillet with a lid
  • wooden spoon
  • tongs or serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.