CookSnap is coming soon — Join the waitlist →

Hungarian Cheese Pogácsa

Tender, flaky savory pastries filled with sharp cheese and caraway seeds. These crispy-edged Hungarian classics are perfect warm from the oven as a snack or appetizer.

Total time
35 min
Servings
12
Calories
248
Protein
8g
Hungarian Cheese Pogácsa
rusticeleganthungarianvegetariancheesecrispyflakytender

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup cold butter, cubed
  • 1.5 cups sharp cheddar cheese, grated
  • ½ cup sour cream
  • 1 teaspoon caraway seeds
  • ½ teaspoon salt

Instructions

  1. 1

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Pour the flour and salt into a large bowl and stir with a fork until mixed evenly.

  3. 3

    Add the cubed cold butter to the flour and use your fingertips to rub the butter into the flour until the mixture looks like coarse breadcrumbs with some pea-sized butter pieces still visible.

  4. 4

    Stir the grated cheese and caraway seeds into the flour mixture until evenly distributed.

  5. 5

    Pour the sour cream into the bowl and stir with a fork until a soft dough forms with no dry flour visible.

  6. 6

    Divide the dough into 12 equal pieces by pinching off golf-ball-sized portions and rolling each between your palms into a smooth ball.

  7. 7

    Place each ball on a parchment-lined baking sheet, spacing them about 2 inches apart so they have room to puff.

  8. 8

    Slide the baking sheet into the preheated 400°F oven and bake until the pogácsa are golden brown on top and a wooden toothpick inserted into the center comes out with no wet dough clinging to it, about 18–20 minutes.

  9. 9

    Remove the baking sheet from the oven and let the pogácsa cool on the pan for 5 minutes before transferring to a wire rack to cool slightly before serving.

Tools you’ll need

  • oven
  • large mixing bowl
  • fork
  • parchment paper
  • baking sheet
  • wooden toothpick
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.