CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Homemade Ricotta Ravioli

Fresh pasta pillows filled with creamy ricotta and herbs, boiled until they float, then finished with butter and sage. Restaurant-quality in 45 minutes.

Total time
45 min
Servings
4
Calories
520
Protein
18g
Homemade Ricotta Ravioli
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

  • 2 cups all-purpose flour
  • 3 whole eggs
  • ½ tsp salt
  • 1 cup ricotta cheese
  • ½ cup Parmesan cheese, grated
  • 2 tbsp fresh parsley, chopped
  • 1 tbsp fresh sage, chopped
  • 4 tbsp butter

Instructions

  1. 1

    Mound flour on a clean surface. Make a well in the center with your fingers.

  2. 2

    Crack eggs into the well and whisk lightly with a fork, breaking the yolks.

  3. 3

    Gradually incorporate flour into the egg mixture, drawing from the inner walls. Knead until shaggy, ~2 minutes.

  4. 4

    Continue kneading until smooth and elastic, about 8–10 minutes. Cover and rest 15 minutes.

  5. 5

    Mix ricotta, Parmesan, parsley, sage, and a pinch of salt in a bowl until combined.

  6. 6

    Divide dough into 4 pieces. Working with one piece at a time, roll thin on a floured surface, ~1/16-inch.

  7. 7

    Cut into 2-inch circles using a round cutter or glass. Place 1 tsp filling in center of each.

  8. 8

    Fold each circle in half, pressing edges firmly to seal. Crimp with a fork for a decorative seal.

  9. 9

    Bring a large pot of salted water to a boil. Working in batches, add ravioli without crowding.

  10. 10

    Stir gently and cook until ravioli rise to the surface, then 1–2 minutes more until tender.

  11. 11

    Remove with a slotted spoon and transfer to a serving dish. Repeat with remaining ravioli.

  12. 12

    Melt butter in a small pan over medium-low heat. Pour over ravioli, tossing gently to coat.

  13. 13

    Season with salt and black pepper. Serve hot with extra Parmesan on the side.

Tools you’ll need

  • large work surface
  • rolling pin
  • 2-inch round cutter
  • fork
  • large pot
  • slotted spoon
  • small saucepan
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.