CookSnap is coming soon — Join the waitlist →
Back to recipes

Kräuterquark mit Kartoffeln

Tender boiled potatoes served with a creamy herb-studded quark sauce, a classic German comfort dish. Naturally vegetarian, ready in under 25 minutes.

Total time
22 min
Servings
2
Calories
215
Protein
14g
Kräuterquark mit Kartoffeln
comfortwholesomegermanvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1.25 lb waxy potatoes (e.g., Yukon Gold)
  • 1 teaspoon salt
  • 1 cup quark or Greek yogurt
  • 2 tablespoons fresh dill, finely chopped
  • 1 tablespoon fresh chives, finely chopped
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Place potatoes in a large pot and cover them completely with cold water from the tap, about 2 inches above the potatoes.

  2. 2

    Add 1 teaspoon salt to the water, then bring to a boil over high heat—you'll see large, rolling bubbles breaking across the entire surface.

  3. 3

    Once boiling, reduce heat to medium and simmer gently until a fork slides through the thickest potato with no resistance, about 15–18 minutes.

  4. 4

    Drain the potatoes in a colander and let them sit in the pot off the heat for 2 minutes to dry slightly.

  5. 5

    While potatoes cook, place quark in a small bowl, then stir in the dill, chives, and 0.25 teaspoon black pepper until the herbs are evenly distributed.

  6. 6

    Divide the warm potatoes between two plates, mounding them in the center of each plate.

  7. 7

    Spoon half of the herb quark sauce onto the side of each plate's potatoes—the sauce should sit in a generous dollop next to, not covering, the potatoes.

Tools you’ll need

  • large pot (4–5 quart)
  • colander
  • small mixing bowl
  • wooden spoon
  • fork
  • two dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.