CookSnap is coming soon — Join the waitlist →
Back to recipes

Harissa Meatballs with Whipped Feta & Rice

Spiced beef meatballs baked with harissa, served over fluffy white rice and topped with creamy whipped feta. A 25-minute Mediterranean dinner that tastes way more impressive than it actually is.

Total time
25 min
Servings
2
Calories
520
Protein
26g
Harissa Meatballs with Whipped Feta & Rice
satisfyingsimplemediterraneanbeeftendercreamyweeknightmain-dish

Ingredients

  • ½ lb ground beef
  • 3 tbsp harissa
  • ¾ cup crumbled feta cheese
  • 1 cup white rice

Instructions

  1. 1

    Start rice in a pot with 2 cups salted water; bring to a boil, then reduce heat and cover.

  2. 2

    Mix ground beef with 2 tbsp harissa and a pinch of salt, then roll into 8–10 balls.

  3. 3

    Place meatballs on a sheet pan and bake at 400°F until cooked through, about 12 minutes.

  4. 4

    While meatballs cool slightly, mash feta with 1 tbsp harissa and 2 tbsp water until creamy.

  5. 5

    Divide rice between bowls, top with meatballs, and dollop whipped feta on the side.

Tools you’ll need

  • 1 pot with lid
  • 1 sheet pan
  • 1 small bowl
  • 1 spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.