Harissa Fish with Carrots & Dill
Spiced white fish and roasted carrots on one sheet pan, finished with bright harissa and fresh dill. North African heat, Scandinavian freshness, 20 minutes.
- Total time
- 20 min
- Servings
- 2
- Calories
- 285
- Protein
- 32g
freshlightmoroccanfishcrispytenderflakyweeknight
Ingredients
- 3 tbsp harissa paste
- 2 tbsp olive oil
- 2 fillets (6 oz each) white fish fillets (cod, halibut, or sea bass)
- 8 oz carrots, cut into 2-inch batons
- ½ whole lemon, cut into wedges
- 2 tbsp fresh dill, chopped
Instructions
- 1
Heat oven to 425°F. Mix harissa and olive oil on a sheet pan.
- 2
Toss carrots in the harissa oil. Spread in a single layer, season with salt and pepper.
- 3
Roast carrots for 8 minutes until they start to soften.
- 4
Push carrots to the sides. Nestle fish fillets in the center, skin-side up.
- 5
Roast 8-10 minutes until fish flakes easily at the thickest point.
- 6
Scatter dill over everything. Serve with lemon wedges.
Tools you’ll need
- sheet pan (18 x 13 inch)
- small bowl for mixing
- spoon for stirring
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
