CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Harissa Fish with Carrots & Dill

Spiced white fish and roasted carrots on one sheet pan, finished with bright harissa and fresh dill. North African heat, Scandinavian freshness, 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
32g
Harissa Fish with Carrots & Dill
freshlightmoroccanfishcrispytenderflakyweeknight

Ingredients

  • 3 tbsp harissa paste
  • 2 tbsp olive oil
  • 2 fillets (6 oz each) white fish fillets (cod, halibut, or sea bass)
  • 8 oz carrots, cut into 2-inch batons
  • ½ whole lemon, cut into wedges
  • 2 tbsp fresh dill, chopped

Instructions

  1. 1

    Heat oven to 425°F. Mix harissa and olive oil on a sheet pan.

  2. 2

    Toss carrots in the harissa oil. Spread in a single layer, season with salt and pepper.

  3. 3

    Roast carrots for 8 minutes until they start to soften.

  4. 4

    Push carrots to the sides. Nestle fish fillets in the center, skin-side up.

  5. 5

    Roast 8-10 minutes until fish flakes easily at the thickest point.

  6. 6

    Scatter dill over everything. Serve with lemon wedges.

Tools you’ll need

  • sheet pan (18 x 13 inch)
  • small bowl for mixing
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.