CookSnap is coming soon — Join the waitlist →
Back to recipes

Harajuku Crepes with Nutella and Fresh Fruit

Paper-thin Japanese crepes filled with Nutella, fresh berries, and whipped cream, then drizzled with condensed milk. Sweet, indulgent, and Instagram-worthy in under an hour.

Total time
45 min
Servings
2
Calories
582
Protein
9g
Harajuku Crepes with Nutella and Fresh Fruit
indulgentelegantjapanesevegetariancrispycreamyfluffydate-night

Ingredients

  • ¾ cup all-purpose flour
  • 1 cup whole milk
  • 2 large eggs
  • 2 tbsp butter, melted
  • ½ cup Nutella or chocolate spread
  • 1.5 cups fresh strawberries and blueberries
  • ½ cup heavy cream
  • 2 tbsp powdered sugar
  • ¼ cup sweetened condensed milk

Instructions

  1. 1

    Whisk flour, milk, eggs, melted butter, and pinch of salt until smooth.

  2. 2

    Strain batter through a fine sieve into a clean bowl. Let rest 15 minutes.

  3. 3

    Whip heavy cream with 1 tbsp powdered sugar until soft peaks form.

  4. 4

    Slice strawberries in half. Pat berries dry with paper towels.

  5. 5

    Heat an 8-inch nonstick skillet over medium-high until a water drop sizzles.

  6. 6

    Pour 3 tbsp batter in center. Immediately tilt skillet in circular motion to spread thin.

  7. 7

    Cook 60 seconds until underside is pale gold, then slide onto a plate.

  8. 8

    Repeat with remaining batter. You should have 4 crepes total.

  9. 9

    Spread 2 tbsp Nutella across the lower half of a crepe, leaving 1-inch border.

  10. 10

    Add a spoonful of whipped cream and a handful of berries on top of Nutella.

  11. 11

    Fold crepe in half, then in half again to form a triangle.

  12. 12

    Repeat with remaining crepes, then drizzle all with condensed milk.

  13. 13

    Dust with remaining powdered sugar and serve immediately.

Tools you’ll need

  • whisk
  • 8-inch nonstick skillet
  • fine sieve
  • electric mixer or whisk
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.