CookSnap is coming soon — Join the waitlist →
Back to recipes

Harajuku Crepes with Matcha & Strawberry

Delicate Japanese-style crepes with sweet matcha cream and fresh strawberries—street food elegance at home. Takes 45 minutes start to finish.

Total time
45 min
Servings
4
Calories
385
Protein
7g
Harajuku Crepes with Matcha & Strawberry
elegantlightjapanesevegetariancrispycreamytenderweeknight

Ingredients

  • 1 cup all-purpose flour
  • 1.25 cups whole milk
  • 2 large eggs
  • 2 tbsp butter, melted
  • 1 tbsp sugar
  • 1.5 tsp matcha powder
  • ½ cup sweetened condensed milk
  • 1 lb fresh strawberries
  • ¾ cup whipped cream

Instructions

  1. 1

    Whisk flour, milk, eggs, melted butter, and sugar until smooth. Let rest 15 minutes.

  2. 2

    Heat a non-stick skillet (8-inch) over medium-high until it shimmers, ~90 seconds.

  3. 3

    Pour 1/4 cup batter and tilt pan in a circular motion until bottom is covered in a thin layer.

  4. 4

    Cook until the bottom is light golden, ~60 seconds, then flip and cook the other side 30 seconds.

  5. 5

    Transfer to a plate. Repeat with remaining batter, stacking crepes as you go.

  6. 6

    Whisk matcha powder into condensed milk until no lumps remain and color is uniform green.

  7. 7

    Fold matcha mixture into whipped cream until combined; do not overmix.

  8. 8

    Hull and slice strawberries into thin strips.

  9. 9

    Place one crepe flat. Spread 2 tbsp matcha cream on one half, arrange strawberries on top.

  10. 10

    Fold crepe in half, then in half again to form a triangle. Drizzle with any remaining cream.

  11. 11

    Serve immediately. Repeat with remaining crepes.

Tools you’ll need

  • 8-inch non-stick skillet
  • medium mixing bowl
  • whisk
  • spatula
  • small bowl
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.