CookSnap is coming soon — Join the waitlist →
Back to recipes

Har Gow (Shrimp & Bamboo Shoot Dumplings)

Delicate, translucent shrimp dumplings with bamboo shoot and chive filling, steamed until tender. A dim sum classic that's easier to fold than you'd think.

Total time
50 min
Servings
4
Calories
180
Protein
12g
Har Gow (Shrimp & Bamboo Shoot Dumplings)
elegantcasualchineseshrimptenderchewysilkyweeknight

Ingredients

  • 1 cup wheat starch (or tapioca starch)
  • ¼ cup potato starch
  • ¾ cup boiling water
  • ½ tbsp vegetable oil
  • ¼ tsp salt
  • ½ lb shrimp, peeled and finely chopped
  • ½ cup bamboo shoot, finely chopped
  • 2 stalks green onion, finely chopped
  • 1 tbsp soy sauce
  • ½ tsp sesame oil

Instructions

  1. 1

    Mix wheat starch, potato starch, and salt in a bowl.

  2. 2

    Pour boiling water into the dry mixture while stirring with a fork until shaggy.

  3. 3

    Once cool enough to handle, knead in vegetable oil until smooth, ~2 minutes.

  4. 4

    Cover dough with plastic wrap and let rest 10 minutes.

  5. 5

    Combine shrimp, bamboo shoot, green onion, soy sauce, and sesame oil in a bowl.

  6. 6

    Stir until evenly mixed. Set aside.

  7. 7

    Divide dough into 12 equal pieces. Roll each into a thin 3-inch circle on oiled plastic.

  8. 8

    Place 1 tbsp filling on each wrapper. Fold and pleat edges to seal, creating a half-moon.

  9. 9

    Line a steamer basket with parchment paper. Arrange dumplings without touching.

  10. 10

    Steam over boiling water for 6 minutes until wrapper turns translucent.

  11. 11

    Serve hot with soy sauce or chili oil for dipping.

Tools you’ll need

  • mixing bowl
  • fork
  • plastic wrap
  • rolling pin (or smooth glass)
  • plastic sheet or parchment paper
  • steamer basket
  • parchment paper
  • pot with lid (for steamer)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.