CookSnap is coming soon — Join the waitlist →
Back to recipes

Haemul Jeongol (Seafood Hot Pot)

A simmering Korean seafood and vegetable hot pot with a savory anchovy broth. Cook seafood and vegetables table-side in one bubbling pot, then dip each bite in spicy sauce.

Total time
25 min
Servings
2
Calories
185
Protein
28g
Haemul Jeongol (Seafood Hot Pot)
cozycomfortkoreanshrimpfishtendersilkyweeknight

Ingredients

  • 4 cups anchovy stock or dashi broth
  • 8 oz shrimp, peeled and deveined
  • 8 oz white fish fillet (cod or halibut), cut into 2-inch chunks
  • 3 cups napa cabbage, chopped into 2-inch pieces
  • 3 tablespoons soy sauce
  • 2 tablespoons gochujang (Korean red chili paste) mixed with 1 tablespoon water and 0.5 teaspoon sesame oil, for dipping

Instructions

  1. 1

    Pat the shrimp and fish pieces dry with paper towels — this helps them brown slightly instead of steaming when they hit the hot broth.

  2. 2

    In a small bowl, stir together the gochujang, water, and sesame oil until smooth — this is your dipping sauce.

  3. 3

    Pour the anchovy stock into a large pot or shallow hot-pot vessel and set it over medium-high heat until small bubbles form around the edges, about 3 minutes.

  4. 4

    Stir 3 tablespoons of soy sauce into the hot broth until fully blended.

  5. 5

    Arrange the shrimp and fish chunks on one side of the pot and the napa cabbage on the other side — they will cook in the simmering broth.

  6. 6

    Maintain the broth at a gentle simmer (small bubbles breaking the surface steadily) and let cook uncovered for 8 minutes, until the shrimp are pink and opaque and the fish is flaky when poked.

  7. 7

    Ladle the broth, seafood, and vegetables into two bowls, dividing evenly.

  8. 8

    Serve each bowl with a small ramekin of the gochujang dipping sauce on the side for each diner to add to taste.

Tools you’ll need

  • large pot or shallow hot-pot vessel (8-10 inches wide)
  • small bowl
  • wooden spoon or ladle
  • paper towels
  • two serving bowls
  • two small ramekins or dipping bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.