Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Fish with Vegetables and Mashed Potatoes

A quick and satisfying weeknight meal featuring a perfectly grilled fish fillet served alongside creamy mashed potatoes and roasted vegetables. Simple ingredients come together in about 20 minutes for a balanced plate.

Total time
20 min
Servings
2
Calories
450
Protein
30g
Grilled Fish with Vegetables and Mashed Potatoes
comfortingamericangluten-freefishflakycreamyweeknightmain course

Ingredients

  • 2 filets fish fillets
  • 2 medium potatoes
  • 1 medium sweet potato
  • 2 tbsp olive oil
  • 1 tbsp butter
  • ½ tsp salt

Instructions

  1. 1

    Peel and chop the 2 potatoes and 1 sweet potato into chunks. Boil in salted water until fork-tender, about 12 minutes.

  2. 2

    While potatoes cook, brush the 2 fish fillets with 1 tbsp olive oil and season with salt. Grill in a hot pan or grill pan for 3-4 minutes per side, until opaque and flaky.

  3. 3

    Drain the potatoes, add 1 tbsp butter and 1 tbsp olive oil, and mash until smooth. Season with salt to taste.

  4. 4

    Serve the grilled fish alongside the mashed potatoes and any roasted vegetables you have on hand.

Tools you’ll need

  • pot
  • grill pan or skillet
  • masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.