CookSnap is coming soon — Join the waitlist →

Greek Ravani Cake

Ravani is a light, syrup-soaked semolina cake from Greece—tender, aromatic, and effortlessly elegant. Baked in one pan and finished with a warm honey-lemon syrup, it's perfect for afternoon tea or a simple dessert.

Total time
50 min
Servings
9
Calories
385
Protein
5g
Greek Ravani Cake
elegantsimplegreekvegetarianfluffytendersoftdessert

Ingredients

  • ½ cup unsalted butter, softened
  • 1 cup sugar
  • 3 large eggs
  • 1.5 cups semolina flour
  • ½ cup all-purpose flour
  • 2 teaspoons baking powder
  • ½ cup plain yogurt
  • 1 cup honey
  • 1 cup water
  • 3 tablespoons lemon juice, fresh
  • 1 whole cinnamon stick
  • 9 whole whole cloves

Instructions

  1. 1

    Set the oven to 350°F and wait for the indicator light or beep to confirm it has finished heating, about 10 minutes.

  2. 2

    Grease a 9-by-13-inch baking pan with a light coating of butter or oil, making sure the bottom and all four sides are covered.

  3. 3

    In a small bowl, whisk together the semolina flour, all-purpose flour, and baking powder until no lumps remain.

  4. 4

    In a large bowl, beat the softened butter and sugar together with an electric mixer on medium speed until the mixture looks light, pale, and fluffy, about 3 minutes.

  5. 5

    Add the eggs one at a time, beating well after each addition until fully combined, about 30 seconds per egg.

  6. 6

    Add half of the flour mixture to the butter mixture and stir gently with a rubber spatula until just combined, about 20 strokes.

  7. 7

    Pour in the yogurt and stir gently until just blended, about 15 strokes.

  8. 8

    Add the remaining flour mixture and stir gently until no dry flour streaks remain, about 20 strokes—do not overmix.

  9. 9

    Pour the batter into the prepared pan and smooth the top with a rubber spatula so it is level.

  10. 10

    Place the pan in the preheated oven and bake until a toothpick inserted in the center comes out clean and the top is golden brown, about 30 minutes.

  11. 11

    While the cake bakes, pour the honey and water into a small saucepan and set it over medium heat.

  12. 12

    Add the cinnamon stick and stir gently for about 30 seconds until fragrant.

  13. 13

    Remove the pan from heat and stir in the fresh lemon juice until blended.

  14. 14

    Set the syrup aside to cool for at least 5 minutes—it should still be warm when you pour it over the hot cake.

  15. 15

    Remove the baked cake from the oven and immediately pour the warm syrup evenly over the entire surface, allowing it to soak in.

  16. 16

    Press one whole clove into the center of each of the nine cake squares (in a 3-by-3 grid pattern) while the cake is still warm.

  17. 17

    Allow the cake to cool in the pan for 15 minutes before serving, so the syrup fully absorbs.

Tools you’ll need

  • 9-by-13-inch baking pan
  • electric mixer
  • large mixing bowl
  • small mixing bowl
  • small saucepan
  • rubber spatula
  • wooden spoon
  • whisk
  • toothpick
  • oven thermometer (optional, to verify oven temperature)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.