CookSnap is coming soon — Join the waitlist →
Back to recipes

Greek Power Bowl with Chicken

Seasoned chicken atop Mediterranean staples—fluffy rice, crisp cucumber, tangy feta—with a bright lemon-herb drizzle. Ready in under 40 minutes and packed with protein.

Total time
40 min
Servings
2
Calories
545
Protein
48g
Greek Power Bowl with Chicken
freshhealthygreekchickentendercrispyweeknightbowl

Ingredients

  • 1 lb chicken breast, boneless skinless
  • 1 cup long-grain white rice
  • 1 medium cucumber, halved lengthwise
  • 1 cup cherry tomatoes
  • ½ cup feta cheese, crumbled
  • 1 whole lemon (zested + juiced)
  • 1 tsp fresh oregano or dried oregano
  • 3 tbsp olive oil

Instructions

  1. 1

    Slice chicken breast horizontally to create two thin cutlets of even thickness.

  2. 2

    Pat chicken dry with paper towels. Season both sides generously with salt, pepper, and oregano.

  3. 3

    Slice cucumber into half-moons. Halve cherry tomatoes. Set vegetables aside.

  4. 4

    Boil rice in salted water until tender and water is absorbed, ~18 minutes. Fluff with a fork.

  5. 5

    While rice cooks, heat 2 tbsp olive oil in a 12-inch skillet over medium-high heat until shimmering.

  6. 6

    Sear chicken 5–6 minutes per side without moving. Edges should look golden; centers cooked through.

  7. 7

    Transfer chicken to a cutting board. Rest 3 minutes, then slice into bite-sized pieces.

  8. 8

    Whisk lemon juice, lemon zest, and remaining 1 tbsp olive oil in a small bowl. Season with salt and pepper.

  9. 9

    Divide cooked rice between two bowls. Top with chicken, cucumber, tomatoes, and feta.

  10. 10

    Drizzle lemon dressing over the bowl. Serve immediately.

Tools you’ll need

  • medium saucepan with lid
  • 12-inch skillet
  • cutting board
  • chef's knife
  • paper towels
  • small bowl
  • whisk
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.