CookSnap is coming soon — Join the waitlist →

Greek Chicken Gyro

Tender marinated chicken wrapped in warm pita with crisp cucumber, tomato, and tangy tzatziki. Ready in 20 minutes with no special equipment needed.

Total time
20 min
Servings
2
Calories
485
Protein
48g
Greek Chicken Gyro
casualfreshgreekchickentendercrispyweeknightlunch

Ingredients

  • ¾ lb boneless, skinless chicken breasts
  • ½ cup Greek yogurt
  • 3 tbsp lemon juice (about 1 lemon)
  • 2 clove garlic, minced
  • 2 piece pita bread
  • 1 cup cucumber, diced
  • 1 cup tomato, diced

Instructions

  1. 1

    Place each chicken breast on a cutting board and, using the flat edge of a chef's knife, gently pound it until it is an even thickness of about 1 inch throughout.

  2. 2

    In a small bowl, mix 0.25 cup of Greek yogurt, 2 tbsp of lemon juice, and the minced garlic until smooth and combined.

  3. 3

    Rub the marinade all over both sides of the chicken breasts, coating them evenly, then let them sit at room temperature for 5 minutes while you prepare the other ingredients.

  4. 4

    Dice the cucumber into 0.5-inch cubes by cutting it lengthwise in half, then slicing across into half-moons, then cutting those into small chunks.

  5. 5

    Dice the tomato by cutting it in half, scooping out the seeds with a spoon, then slicing into 0.5-inch pieces.

  6. 6

    Heat a large skillet over medium-high heat and add 1 tbsp of olive oil; when the oil shimmers and slides quickly when you tilt the pan, lay the chicken breasts in.

  7. 7

    Cook the chicken without moving it for 5 minutes, then flip it over and cook the other side for another 5 minutes, until the surface is golden and the thickest part reaches 165°F on a meat thermometer.

  8. 8

    Transfer the cooked chicken to a cutting board and let it rest for 2 minutes, then slice it against the grain into strips about 0.25 inch wide.

  9. 9

    Warm the pita bread by placing each one directly on a stovetop flame for 10 seconds per side, or by wrapping them in a damp paper towel and microwaving for 15 seconds.

  10. 10

    Open each warm pita to form a pocket by carefully cutting off about 1 inch from one edge to create an opening.

  11. 11

    Spread 1.5 tbsp of Greek yogurt mixed with 0.5 tbsp of lemon juice inside each pita pocket.

  12. 12

    Divide the sliced chicken evenly between the two pitas, pushing it down into the bottom of the pocket.

  13. 13

    Top each gyro with half of the diced cucumber and half of the diced tomato, filling the pocket generously.

Tools you’ll need

  • cutting board
  • chef's knife
  • small bowl
  • measuring spoons
  • large skillet (12 inch)
  • meat thermometer
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.