CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Minute Greek Chicken Bowl

Pan-seared chicken breast over rice with cool cucumber and creamy tzatziki. Ready in 15 minutes with four simple ingredients.

Total time
15 min
Servings
2
Calories
420
Protein
38g
15-Minute Greek Chicken Bowl
lightfreshgreekchickentendercrispyweeknightbowl

Ingredients

  • 2 pieces (about 6 oz each) chicken breast
  • 1.5 cups rice (cooked)
  • 1 medium, diced cucumber
  • ½ cup tzatziki

Instructions

  1. 1

    Pat chicken dry with paper towels. Season both sides generously with salt and black pepper.

  2. 2

    Heat 1 tbsp oil in a skillet over medium-high until shimmering. Sear chicken 5–6 minutes per side until golden and cooked through. Transfer to a plate and rest 2 minutes, then slice.

  3. 3

    Warm rice if needed: microwave in a covered bowl 1–2 minutes, or use room-temperature cooked rice.

  4. 4

    Divide rice between two bowls. Top with sliced chicken, diced cucumber, and a generous dollop of tzatziki. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • cutting board
  • knife
  • two bowls
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.