CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Goan Fish Rava Fry

Crispy-coated pan-fried fish with a savory semolina crust, finished with fresh lemon and cilantro. A vibrant, restaurant-quality dish ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
218
Protein
28g
Goan Fish Rava Fry
freshcasualindiangluten-freefishcrispytenderweeknight

Ingredients

  • ½ lb white fish fillets (cod, halibut, or pomfret)
  • ½ cup semolina (rava)
  • ½ tsp red chili powder
  • ¼ tsp turmeric powder
  • 1 whole lemon
  • 2 tbsp fresh cilantro, chopped

Instructions

  1. 1

    Pat the fish fillets dry with paper towels on both sides, pressing gently to remove all surface moisture, so the coating will stick.

  2. 2

    Mix the semolina, chili powder, turmeric powder, and 0.5 teaspoon salt in a shallow bowl until the color is uniform throughout.

  3. 3

    Cut the lemon in half; keep one half whole for juicing and slice the other half into thin wedges for serving.

  4. 4

    Pour 2 tablespoons of oil into a large skillet and set it over medium-high heat until the oil shimmers and slides quickly across the pan, about 90 seconds.

  5. 5

    Coat each fish fillet by pressing it firmly into the semolina mixture on both sides, shaking off excess, until the fillet is covered in a thin, even crust.

  6. 6

    Carefully lay the coated fillets in the hot oil, spacing them so they do not touch, and cook without moving for 3 to 4 minutes until the bottom is golden brown and sounds crispy when you tap it with a spatula.

  7. 7

    Using a thin metal spatula, slide it under one fillet, lift it high enough to peek underneath, and flip it over once the underside is golden; repeat with each fillet.

  8. 8

    Cook the second side for 2 to 3 minutes until it turns golden brown and the flesh inside is opaque white when you flake it gently with a fork.

  9. 9

    Transfer the fillets to a serving plate and squeeze the juice from the lemon half evenly over all the fish.

  10. 10

    Scatter the chopped cilantro over the top and arrange the lemon wedges on the side for squeezing at the table.

Tools you’ll need

  • paper towels
  • shallow bowl
  • cutting board
  • knife
  • large skillet (10–12 inch)
  • thin metal spatula
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.