Garlic Tomato Bruschetta
Crispy bread topped with bright, garlicky tomatoes and fresh basil. No cooking required — just toast, chop, and serve in under 10 minutes.
- Total time
- 10 min
- Servings
- 4
- Calories
- 185
- Protein
- 5g
freshsimpleitalianvegetariancrispyjuicyweeknightparty
Ingredients
- 1 loaf (halved lengthwise) Baguette or ciabatta
- 4 whole Tomatoes (ripe, medium)
- 3 cloves Garlic
- ¼ cup (packed) Fresh basil
- 3 tbsp Olive oil
- 1 tbsp Red wine vinegar or balsamic vinegar
Instructions
- 1
Slice bread diagonally into 0.5-inch-thick pieces. Arrange on a sheet pan.
- 2
Broil 4 inches from heat until bread is golden and crisp, 2-3 minutes per side.
- 3
Dice tomatoes into small chunks. Mince garlic and tear basil leaves.
- 4
Toss tomatoes with garlic, basil, olive oil, vinegar, salt, and pepper.
- 5
Spoon tomato mixture onto warm toast. Serve immediately.
Tools you’ll need
- sheet pan
- bread knife
- cutting board
- small bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
