CookSnap is coming soon — Join the waitlist →
Back to recipes

Garlic Shrimp Stir-Fry

Quick, garlicky shrimp with snap peas and bell pepper in a savory soy-ginger sauce. Ready in 20 minutes and perfect over rice.

Total time
20 min
Servings
2
Calories
245
Protein
28g
Garlic Shrimp Stir-Fry
quicksatisfyingchineseshrimpcrispytendercrunchyweeknight

Ingredients

  • 3 tbsp soy sauce
  • 1 tbsp ginger, minced
  • 4 cloves garlic cloves, minced
  • 1 lb shrimp, peeled and deveined
  • 8 oz snap peas
  • 1 medium red bell pepper, sliced
  • 2 tbsp olive oil
  • 1 to taste salt and pepper to taste

Instructions

  1. 1

    Whisk together soy sauce, ginger, and garlic in a small bowl. Set aside.

  2. 2

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  3. 3

    Heat oil in a 12-inch skillet over medium-high until shimmering, about 60 seconds.

  4. 4

    Add shrimp in a single layer. Cook 90 seconds without stirring until one side turns opaque.

  5. 5

    Flip shrimp and cook another 90 seconds until just cooked through. Transfer to a plate.

  6. 6

    Add bell pepper and snap peas to the same skillet. Stir-fry for 3 minutes until tender-crisp.

  7. 7

    Pour the garlic-soy sauce into the skillet and stir constantly for 30 seconds until fragrant.

  8. 8

    Return shrimp to the skillet and toss to coat. Cook for 30 seconds to heat through.

  9. 9

    Taste and adjust salt and pepper. Serve hot over steamed rice.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • whisk
  • paper towels
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.