CookSnap is coming soon — Join the waitlist →

Garlic Butter Pasta with Spinach

Five-ingredient pasta that tastes like restaurant cooking. Hot pasta tossed with melted garlic butter and wilted spinach, finished with lemon and Parmesan.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Garlic Butter Pasta with Spinach
simplequickitalianvegetariansilkytenderweeknightpasta

Ingredients

  • 8 oz spaghetti or linguine
  • 3 tbsp butter
  • 3 cloves garlic, minced
  • 3 cups fresh spinach, loosely packed
  • ½ cup Parmesan cheese, grated

Instructions

  1. 1

    Boil salted water in a large pot. Add pasta and cook until al dente, ~9 minutes.

  2. 2

    While pasta cooks, melt butter in a large skillet over medium heat, ~1 minute.

  3. 3

    Add minced garlic and cook until fragrant, ~45 seconds. Do not brown.

  4. 4

    Reserve 0.5 cup pasta water, then drain pasta. Set aside.

  5. 5

    Add spinach to the skillet with garlic butter and stir until wilted, ~60 seconds.

  6. 6

    Add hot pasta to the skillet and toss to coat. Pour in reserved pasta water gradually.

  7. 7

    Stir in half the Parmesan until the sauce is silky. Top with remaining Parmesan.

  8. 8

    Serve immediately with cracked black pepper and lemon wedges.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • microplane or box grater
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.