CookSnap is coming soon — Join the waitlist →
Back to recipes

Fresh Spring Rolls with Peanut Sauce

Chewy rice paper wraps filled with fresh vegetables, herbs, and vermicelli noodles, served with a creamy peanut dipping sauce. Ready in 30 minutes.

Total time
30 min
Servings
4
Calories
280
Protein
9g
Fresh Spring Rolls with Peanut Sauce
freshlightvietnamesevegetarianveganvegetarianchewycrunchy

Ingredients

  • 3 oz rice vermicelli noodles
  • 12 wrappers rice paper wrappers (8-inch)
  • 1 medium cucumber
  • 2 medium carrots
  • 1 cup fresh mint and cilantro (loosely packed)
  • ⅓ cup peanut butter
  • 2 tbsp lime juice
  • 1 tbsp fish sauce or soy sauce

Instructions

  1. 1

    Cook vermicelli in boiling salted water until tender, about 4 minutes. Drain and rinse with cold water.

  2. 2

    Slice cucumber and carrots into thin matchsticks about 2 inches long.

  3. 3

    Make peanut sauce: whisk peanut butter, lime juice, fish sauce, and 3 tbsp water until smooth.

  4. 4

    Fill a shallow bowl with warm water. Dip one rice paper wrapper in water for 3 seconds until pliable.

  5. 5

    Lay wrapper on a clean cutting board. Arrange a small handful of noodles, cucumber, carrots, and herbs in center.

  6. 6

    Fold the bottom edge over the filling, then fold in the sides and roll tightly to seal.

  7. 7

    Repeat with remaining wrappers and fillings. Arrange seam-side down on a platter.

  8. 8

    Serve rolls with peanut sauce on the side for dipping.

Tools you’ll need

  • large pot
  • shallow bowl for water
  • cutting board
  • sharp knife
  • whisk or spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.