CookSnap is coming soon — Join the waitlist →
Back to recipes

Fresh Shrimp Summer Rolls

Springy rice paper wraps filled with cold poached shrimp, herbs, and crisp vegetables. Serve with a tangy fish sauce dipping sauce—no cooking skills required, just assembly.

Total time
20 min
Servings
2
Calories
156
Protein
18g
Fresh Shrimp Summer Rolls
freshlightsimplevietnamesedairy-freegluten-freeshrimptender

Ingredients

  • 12 count large shrimp, peeled and deveined
  • 8 count rice paper wrappers (8-inch)
  • 1 cup fresh herbs (mint, cilantro, Thai basil), chopped
  • 1 medium cucumber, cut into thin matchsticks
  • 3 tbsp fish sauce
  • 1 count lime (juiced)

Instructions

  1. 1

    Bring a pot of salted water to a boil. Add shrimp and cook until pink and opaque, 2-3 minutes. Drain and let cool.

  2. 2

    Fill a shallow bowl with warm water. Dip one rice paper wrapper for 3-4 seconds until pliable, then lay on a clean surface.

  3. 3

    Arrange a small handful of herbs and cucumber in the center, top with one shrimp halved lengthwise, then roll tightly into a cylinder, tucking in the sides as you go.

  4. 4

    Repeat with remaining wrappers, herbs, cucumber, and shrimp until all are filled.

  5. 5

    Whisk fish sauce, lime juice, and 2 tbsp water in a small bowl until combined. Taste and adjust.

  6. 6

    Serve rolls at room temperature with fish sauce dipping sauce on the side.

Tools you’ll need

  • large pot
  • shallow bowl (for water bath)
  • cutting board
  • sharp knife
  • small bowl (for sauce)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.