CookSnap is coming soon — Join the waitlist →

French Palmier Cookies

Crispy, caramelized spiral cookies made from puff pastry and cinnamon sugar. These elegant French treats bake in 20 minutes and require just 5 core ingredients.

Total time
35 min
Servings
24
Calories
87
Protein
1g
French Palmier Cookies
elegantindulgentfrenchvegetariancrispyflakyholidayparty

Ingredients

  • ¼ cup all-purpose flour
  • 1 sheet (14 oz) puff pastry, thawed
  • ⅓ cup granulated sugar
  • 1.5 tsp ground cinnamon
  • 2 tbsp butter, melted
  • 2 tbsp coarse sugar for topping
  • ¼ tsp salt

Instructions

  1. 1

    Preheat oven to 400°F. Line two baking sheets with parchment paper.

  2. 2

    Mix granulated sugar, cinnamon, and salt in a small bowl until evenly combined.

  3. 3

    Dust a work surface lightly with flour. Unfold puff pastry and lay flat.

  4. 4

    Brush pastry with melted butter, leaving a 1/4-inch border on all sides.

  5. 5

    Sprinkle cinnamon sugar evenly over buttered pastry, pressing gently to adhere.

  6. 6

    Starting from one long edge, roll pastry tightly toward the center until you reach the middle, then repeat from the opposite edge. The two rolls will meet in the middle.

  7. 7

    Freeze the rolled pastry for 10 minutes until firm enough to slice cleanly.

  8. 8

    Slice into 3/4-inch-thick rounds using a sharp knife. Place flat on prepared baking sheets.

  9. 9

    Sprinkle coarse sugar on top of each palmier. Bake 18–22 minutes until golden and caramelized.

  10. 10

    Cool on baking sheet for 5 minutes, then transfer to a wire rack to cool completely.

Tools you’ll need

  • baking sheets (2)
  • parchment paper
  • small mixing bowl
  • pastry brush
  • work surface
  • sharp knife
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.