CookSnap is coming soon — Join the waitlist →
Back to recipes

Fish Head Curry

Malaysian-style curry built on fish heads simmered in a vibrant spice paste with coconut milk. Rich, aromatic, ready in under 20 minutes with pantry staples.

Total time
20 min
Servings
2
Calories
380
Protein
38g
Fish Head Curry
comfortboldmalaysianfishtendersilkyweeknightcurry

Ingredients

  • 1.5 lb fish heads (snapper, grouper, or mackerel), cleaned and halved
  • 3 tbsp red curry paste (or Malaysian curry paste)
  • 1 can (13.5 oz) coconut milk, full-fat
  • 1 cup fish or seafood stock
  • 8 oz okra or green beans, cut into 2-inch pieces
  • 1 cup cherry tomatoes, halved
  • 1 lime + handful cilantro fresh lime (juiced) and fresh cilantro, chopped

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet or shallow pan over medium-high heat until shimmering.

  2. 2

    Add curry paste and fry for 90 seconds, stirring often, until fragrant and oil separates.

  3. 3

    Pour in coconut milk and stock, stirring to combine. Bring to a gentle simmer.

  4. 4

    Slide fish heads into the liquid. Simmer 6–7 minutes until flesh flakes easily from bones.

  5. 5

    Add okra and tomatoes. Cook 3 minutes until vegetables are tender-crisp.

  6. 6

    Squeeze lime juice over the top. Taste and season with salt and pepper. Garnish with cilantro.

Tools you’ll need

  • 12-inch skillet or shallow pan with lid (optional)
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.