CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Fattet Hummus

Creamy hummus topped with crispy pita chips, warm spiced chickpeas, and a drizzle of olive oil infused with garlic and sumac. A showstopping Lebanese breakfast that's ready in under 15 minutes.

Total time
12 min
Servings
4
Calories
485
Protein
12g
Fattet Hummus
elegantfreshlebanesevegetarianveganchickpeascreamycrispy

Ingredients

  • 1 can (15 oz) canned chickpeas, drained and rinsed
  • ¼ cup tahini
  • 2 whole garlic cloves
  • 1 whole lemon, juiced
  • ½ cup olive oil, divided
  • 2 whole pita bread
  • 1 tsp sumac

Instructions

  1. 1

    Pulse chickpeas, tahini, garlic, and lemon juice in a food processor until mostly smooth.

  2. 2

    With motor running, drizzle in 0.25 cup olive oil until hummus is light and creamy.

  3. 3

    Season with salt and pepper to taste. Transfer to a shallow bowl.

  4. 4

    Cut pita into triangles. Heat remaining 0.25 cup olive oil in a skillet over medium-high.

  5. 5

    Fry pita triangles in batches until golden and crispy, about 2 minutes per batch.

  6. 6

    Arrange hot pita chips over hummus. Drizzle with the pan's garlic-infused oil.

  7. 7

    Sprinkle sumac over the top and serve immediately while pita is still warm.

Tools you’ll need

  • food processor
  • 12-inch skillet
  • shallow serving bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.