CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Min Espresso Custard Tarts

No-bake custard tarts filled with silky egg custard and topped with a shot of espresso. Ready in 5 minutes, no oven needed.

Total time
5 min
Servings
4
Calories
185
Protein
4g
5-Min Espresso Custard Tarts
elegantsimplechinesevegetarianeggssilkysmoothflaky

Ingredients

  • 8 count store-bought mini phyllo cups or tartlet shells
  • 3 count egg yolks
  • ⅓ cup sweetened condensed milk
  • ½ tsp vanilla extract
  • ¼ cup espresso (cooled)
  • 1 tbsp cocoa powder (optional, for dusting)

Instructions

  1. 1

    Whisk egg yolks, condensed milk, and vanilla until the mixture is pale and smooth.

  2. 2

    Pour custard mixture evenly into each tartlet shell until three-quarters full.

  3. 3

    Refrigerate tarts for 3 minutes while espresso cools to room temperature.

  4. 4

    Top each tart with 1 tbsp cooled espresso, letting it pool slightly on the surface.

  5. 5

    Dust lightly with cocoa powder if desired. Serve immediately or chill up to 1 hour.

Tools you’ll need

  • small whisk or fork
  • small bowl
  • spoon or small ladle
  • refrigerator

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.