English Muffin Pizza
Crispy English muffins topped with marinara, melted cheese, and optional pepperoni, ready in 10 minutes. Perfect snack or light lunch that feels like real pizza.
- Total time
- 10 min
- Servings
- 2
- Calories
- 380
- Protein
- 16g
quickcasualamericanvegetariancrispymeltyweeknightsnack
Ingredients
- 2 whole English muffins
- ½ cup marinara sauce
- 1 cup shredded mozzarella cheese
- ¼ cup pepperoni slices (optional)
- 1 tbsp olive oil
Instructions
- 1
Split each English muffin in half. Arrange cut-side up on a sheet pan.
- 2
Preheat broiler to high. Position oven rack 4 inches from heat.
- 3
Spread 2 tablespoons marinara on each muffin half. Leave a thin border.
- 4
Top each half with mozzarella, pepperoni if using, and a light drizzle of oil.
- 5
Broil 3–4 minutes until cheese bubbles and mozzarella edges brown slightly.
- 6
Let cool 2 minutes. Serve hot.
Tools you’ll need
- sheet pan
- broiler
- spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
