Custrd is out on the App Store — Download it free →
Back to recipes

Empanadas with Guacamole

Golden, flaky empanadas filled with a savory beef and onion mixture, served with a fresh, creamy guacamole. Perfect for a weeknight dinner or casual gathering.

Total time
40 min
Servings
4
Calories
550
Protein
25g
Empanadas with Guacamole
comfortingLatin Americanbeefflakycreamyweeknightmaindinner

Ingredients

  • 8 discs empanada dough discs
  • 1 lb ground beef
  • 1 medium onion
  • 1 tsp cumin
  • 2 ripe avocado
  • 1 juiced lime
  • 1 tsp salt
  • 2 tbsp olive oil

Instructions

  1. 1

    Heat 1 tbsp olive oil in a skillet over medium-high. Add 1 diced onion and cook until soft, about 5 minutes.

  2. 2

    Add 1 lb ground beef and 1 tsp cumin. Cook, breaking up meat, until browned and no longer pink, about 8 minutes. Season with 1/2 tsp salt. Let cool slightly.

  3. 3

    Preheat oven to 400°F. Place 8 empanada discs on a work surface. Spoon about 2 tbsp filling onto each. Fold and press edges with a fork to seal.

  4. 4

    Brush empanadas with remaining 1 tbsp olive oil. Bake until golden brown, 20-25 minutes.

  5. 5

    Mash 2 avocados with juice of 1 lime and 1/2 tsp salt. Serve empanadas warm with guacamole.

Tools you’ll need

  • skillet
  • baking sheet
  • fork
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.