Custrd is out on the App Store — Download it free →
Back to recipes

Empanadas with Fried Onions

Golden, flaky empanadas filled with savory beef and topped with sweet, caramelized fried onions and fresh herbs. A satisfying weeknight dinner that's easier than you think.

Total time
45 min
Servings
4
Calories
550
Protein
25g
Empanadas with Fried Onions
comfortingLatin Americanbeefflakycrispyweeknightmaindinner

Ingredients

  • 8 discs empanada dough discs
  • 1 lb ground beef
  • 2 large onions
  • 3 tbsp olive oil
  • 1 tsp paprika
  • 1 tsp salt
  • ½ tsp black pepper
  • ¼ cup fresh parsley

Instructions

  1. 1

    Thinly slice 1 onion. Heat 2 tbsp olive oil in a skillet over medium heat. Add the sliced onion and cook, stirring often, until deep golden and caramelized, about 15 minutes. Transfer to a bowl.

  2. 2

    In the same skillet, add 1 tbsp olive oil and 1 lb ground beef. Cook over medium-high heat, breaking up the meat, until browned and cooked through, about 8 minutes. Season with 1 tsp paprika, 1 tsp salt, and 0.5 tsp black pepper.

  3. 3

    Stir the caramelized onions into the beef mixture. Remove from heat and let cool slightly. Chop 0.25 cup fresh parsley and stir it into the filling.

  4. 4

    Preheat oven to 400°F. Place 8 empanada discs on a work surface. Spoon about 2 tbsp of filling onto the center of each disc. Fold the dough over to form a half-moon and press edges with a fork to seal.

  5. 5

    Arrange the empanadas on a baking sheet lined with parchment paper. Brush the tops with a little olive oil or beaten egg if desired. Bake until golden brown and crisp, about 20 minutes.

  6. 6

    While they bake, thinly slice the remaining 1 onion. Heat 1 tbsp olive oil in a skillet over medium heat and fry the onion until crispy and golden, about 10 minutes. Drain on paper towels.

  7. 7

    Serve the hot empanadas topped with the crispy fried onions and extra parsley if you like.

Tools you’ll need

  • skillet
  • baking sheet
  • parchment paper
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.