CookSnap is coming soon — Join the waitlist →

Empanadas Colombianas con Ají

Crispy fried pastries filled with seasoned ground beef and potatoes, served with a vibrant cilantro-jalapeño sauce. A beloved Colombian comfort food ready in under an hour.

Total time
55 min
Servings
4
Calories
420
Protein
12g
Empanadas Colombianas con Ají
comfortcasualcolombianbeefcrispytenderweeknightdinner

Ingredients

  • ½ lb ground beef
  • ½ lb potato, diced small
  • 12 count empanada wrappers (discos)
  • ½ medium onion, diced
  • ¼ cup fresh cilantro, chopped
  • 1 count jalapeño, minced
  • 3 cups vegetable oil for frying

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering.

  2. 2

    Add diced potato and cook without stirring, 2 minutes per side, until light golden.

  3. 3

    Push potatoes to the side. Add ground beef, break apart with a spoon, cook until no pink remains, ~5 minutes.

  4. 4

    Add diced onion, stir, and cook until soft and fragrant, 2 minutes.

  5. 5

    Season with salt and pepper. Remove from heat and let cool 5 minutes.

  6. 6

    Place 1.5 tbsp filling slightly off-center on each empanada wrapper.

  7. 7

    Fold wrapper in half and press edges firmly to seal. Crimp with a fork if desired.

  8. 8

    Heat 3 cups oil in a deep pot to 350°F. Fry empanadas in batches, 3 minutes per side, until deep golden.

  9. 9

    Transfer to a paper-towel-lined plate.

  10. 10

    Mix cilantro and jalapeño with 2 tbsp water and pinch of salt for ají sauce.

  11. 11

    Serve empanadas hot with ají sauce on the side.

Tools you’ll need

  • large skillet
  • deep pot (at least 4 quarts)
  • cooking thermometer
  • wooden spoon
  • fork (for crimping)
  • paper towels
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.