CookSnap is coming soon — Join the waitlist →
Back to recipes

Egyptian Mahshi: Stuffed Vegetables

Hollowed zucchini and tomatoes stuffed with spiced rice and herbs, then simmered in tomato sauce. A vegetarian Egyptian classic that's hearty, fragrant, and deeply satisfying.

Total time
55 min
Servings
4
Calories
285
Protein
7g
Egyptian Mahshi: Stuffed Vegetables
comfortwholesomeegyptianmediterraneanvegetarianvegetariantenderfluffy

Ingredients

  • 4 whole zucchini, medium
  • 4 whole tomatoes, medium
  • 1 cup short-grain white rice, uncooked
  • 1 medium onion, finely diced
  • ½ cup fresh parsley and dill, chopped
  • 1.5 cans (28 oz each) canned crushed tomatoes
  • 4 tbsp olive oil
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Trim zucchini ends. Using a vegetable corer or thin knife, hollow out centers, leaving 1/4-inch shell. Reserve scooped flesh.

  2. 2

    Cut off zucchini-sized tops from tomatoes. Scoop out insides with a spoon, leaving thin shells. Reserve pulp.

  3. 3

    Chop reserved zucchini flesh and tomato pulp into small pieces.

  4. 4

    Heat 2 tbsp oil in a large pot over medium-high. Add diced onion, cook 4 minutes until soft and translucent.

  5. 5

    Add rice, stir 2 minutes until lightly toasted and fragrant.

  6. 6

    Stir in reserved zucchini and tomato pieces, parsley, dill, salt, and pepper. Cook 2 minutes, then remove from heat.

  7. 7

    Spoon rice mixture evenly into hollowed zucchini and tomato shells. Stand them upright in the same pot.

  8. 8

    Pour crushed tomatoes around the vegetables. Drizzle with remaining 2 tbsp oil, add 1 cup water.

  9. 9

    Bring to a boil over medium-high heat, then reduce to medium-low, cover, and simmer 35 minutes until rice is tender.

  10. 10

    Serve hot with sauce spooned over and around the vegetables.

Tools you’ll need

  • vegetable corer or thin sharp knife
  • large pot with lid (12-inch or larger)
  • spoon or small ice-cream scoop
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.