CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Eggs Florentine with Hollandaise

Poached eggs and wilted spinach on toasted English muffins, topped with silky hollandaise. A showstopping breakfast that tastes fancy but comes together in 30 minutes.

Total time
30 min
Servings
2
Calories
512
Protein
18g
Eggs Florentine with Hollandaise
elegantindulgentfrenchvegetarianeggscreamytendercrispy

Ingredients

  • 4 cups fresh spinach
  • 4 whole eggs
  • 2 whole English muffins
  • 6 tbsp butter
  • 3 whole egg yolks
  • 1 tbsp lemon juice
  • 1 tbsp white vinegar
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Melt 6 tbsp butter in a small saucepan over low heat, ~2 minutes. Set aside.

  2. 2

    Whisk 3 egg yolks with 1 tbsp lemon juice in a heatproof bowl.

  3. 3

    Set bowl over (not touching) simmering water. Whisk constantly until pale and thick, ~4 minutes.

  4. 4

    Remove from heat. Drizzle in melted butter while whisking constantly until silky and pale.

  5. 5

    Season with salt and pepper. Cover loosely and set aside.

  6. 6

    Toast English muffins until edges crisp, ~3 minutes. Transfer to plates.

  7. 7

    Heat 1 tbsp butter in a large skillet over medium. Add spinach and cook until wilted, ~1 minute.

  8. 8

    Season spinach with salt and pepper. Divide evenly between muffin halves.

  9. 9

    Bring a shallow pot of water to a bare simmer. Add 1 tbsp white vinegar.

  10. 10

    Crack 1 egg into a small cup. Gently slide into simmering water. Repeat with remaining eggs.

  11. 11

    Poach until whites set but yolks still jiggle when shaken, ~3 minutes.

  12. 12

    Remove eggs with a slotted spoon. Set 1 egg on each spinach-topped muffin half.

  13. 13

    Spoon hollandaise over eggs. Serve immediately.

Tools you’ll need

  • small saucepan
  • heatproof bowl
  • whisk
  • large skillet
  • shallow poaching pot
  • slotted spoon
  • toaster
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.