CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Dutch Pannenkoeken with Caramelized Apples & Cinnamon

Thin, tender Dutch pancakes served warm with spiced caramelized apples and a dusting of powdered sugar. A cozy vegetarian dinner that feels elegant but comes together in under an hour.

Total time
45 min
Servings
4
Calories
380
Protein
8g
Dutch Pannenkoeken with Caramelized Apples & Cinnamon
comfortelegantdutchvegetarianeggstendercrispyweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • 3 whole eggs
  • 1.5 cups whole milk
  • 6 tbsp butter, divided
  • ¼ tsp salt
  • 4 medium apples, peeled and sliced thin
  • 3 tbsp sugar
  • 1 tsp ground cinnamon
  • 1 tbsp lemon juice
  • 2 tbsp powdered sugar
  • ¼ tsp fresh lemon zest

Instructions

  1. 1

    Whisk flour and salt in a large bowl. Make a well in the center.

  2. 2

    Crack eggs into the well. Pour milk around them. Whisk until smooth and thin, like heavy cream.

  3. 3

    Melt 1 tbsp butter and stir into batter. Let rest 15 minutes at room temperature.

  4. 4

    Melt 2 tbsp butter in a large skillet over medium. Add apple slices in a single layer.

  5. 5

    Sprinkle sugar and cinnamon over apples. Cook 8 minutes without stirring until golden at edges.

  6. 6

    Flip apples in batches. Cook 4 minutes until the second side browns and caramelizes.

  7. 7

    Drizzle lemon juice over apples. Stir gently for 30 seconds to coat. Transfer to a plate.

  8. 8

    Heat a 10-inch nonstick skillet or crepe pan over medium-high until a drop of water sizzles, ~1 minute.

  9. 9

    Add 0.5 tbsp butter. Tilt pan to coat evenly. Pour in 1/4 cup batter, immediately tilting to spread thin.

  10. 10

    Cook 60 seconds until the bottom is speckled light golden. Flip carefully with a thin spatula.

  11. 11

    Cook the second side 30 seconds until set but still tender. Slide onto a plate.

  12. 12

    Repeat with remaining batter (makes 8–10 pannenkoeken). Brush skillet with butter between batches.

  13. 13

    Stack warm pannenkoeken on a serving platter. Top with caramelized apples.

  14. 14

    Dust with powdered sugar and lemon zest. Serve immediately while still warm.

Tools you’ll need

  • 10-inch nonstick skillet or crepe pan
  • large bowl
  • whisk
  • thin metal spatula
  • measuring cups and spoons
  • vegetable peeler
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.