CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Doro Wat with Boiled Egg

A simplified Ethiopian chicken stew simmered in a rich, spiced onion-and-tomato sauce, topped with a hard-boiled egg. Deeply flavorful and ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
485
Protein
38g
Doro Wat with Boiled Egg
comfortheartyethiopianchickeneggstendercreamyweeknight

Ingredients

  • 1 whole large yellow onion
  • 1 lb chicken thighs, bone-in and skin-on
  • ¾ cup canned crushed tomatoes
  • 1.5 teaspoon paprika
  • 1 teaspoon ginger, minced
  • 2 whole eggs

Instructions

  1. 1

    Fill a small pot with water and bring it to a boil over high heat, about 5 minutes. Once boiling, carefully add 2 eggs and set a timer for 10 minutes so they become hard-boiled.

  2. 2

    Cut the onion in half from root to tip, then place each half flat-side down and slice lengthwise into thin half-moons, about 1/4-inch thick.

  3. 3

    Mince the ginger until the pieces are smaller than a grain of rice — about the size of pencil-tip dots.

  4. 4

    Heat 2 tablespoons of olive oil in a 12-inch skillet over medium-high heat until the oil shimmers and moves quickly when you tilt the pan, about 90 seconds.

  5. 5

    Add the sliced onion to the hot oil and stir every 30 seconds until the onion turns golden brown and soft, about 8 minutes. You will smell a sweet, caramelized aroma when it is ready.

  6. 6

    Stir the paprika and minced ginger into the onion for 30 seconds until the spices smell strongly fragrant and coat the onion.

  7. 7

    Add the chicken thighs to the skillet and turn them in the onion mixture so all sides are coated, about 1 minute.

  8. 8

    Pour in 0.75 cup crushed tomatoes and stir once to combine. Add 0.5 teaspoon salt and a pinch of black pepper.

  9. 9

    Reduce the heat to medium-low, cover the skillet with a lid, and simmer for 10 minutes until the chicken is cooked through — the internal temperature in the thickest part should reach 165°F on a meat thermometer.

  10. 10

    When the eggs have finished boiling (the timer will alert you), remove them from the hot water with a slotted spoon and place them in a bowl of cold water to cool for 1 minute.

  11. 11

    Peel the cooled eggs by gently tapping the shell all over, then rolling the egg on a hard surface to crack it, and peel away the shell pieces under cool running water.

  12. 12

    Divide the chicken and sauce between two shallow bowls, spooning extra sauce on top of each chicken piece.

  13. 13

    Cut each peeled egg in half lengthwise and place both halves yolk-side up on top of each serving.

Tools you’ll need

  • small pot
  • slotted spoon
  • 12-inch skillet with lid
  • cutting board
  • chef's knife
  • wooden spoon or rubber spatula
  • meat thermometer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.