CookSnap is coming soon — Join the waitlist →
Back to recipes

Deep-Fried Taro Dumplings

Crispy golden taro dumplings with a savory mushroom-sesame filling, fried until the exterior shatters and the inside stays creamy. Serve with sweet-and-sour dipping sauce for the perfect vegetarian appetizer or light dinner.

Total time
45 min
Servings
4
Calories
320
Protein
4g
Deep-Fried Taro Dumplings
indulgentcelebrationchinesevegetarianvegetariancrispycreamyfluffy

Ingredients

  • 1 lb taro root, peeled
  • 8 oz mushrooms, finely chopped
  • 3 whole scallions, chopped
  • 2 tbsp sesame oil
  • 2 tbsp soy sauce
  • 3 tbsp cornstarch
  • 4 cups oil for frying

Instructions

  1. 1

    Cut taro into 1-inch chunks. Steam in a covered pot until fork-tender, ~15 minutes.

  2. 2

    While taro cooks, sauté mushrooms in a skillet over medium-high until golden, ~5 minutes.

  3. 3

    Stir in scallions, sesame oil, and soy sauce. Cook 1 minute until fragrant. Set aside.

  4. 4

    Mash hot taro until smooth. Fold in cornstarch, then the mushroom mixture until combined.

  5. 5

    Let taro mixture cool 5 minutes, then scoop into 1.5-inch balls using two spoons.

  6. 6

    Heat oil in a heavy pot to 350°F. Fry dumplings in batches until deep golden, ~3 minutes.

  7. 7

    Transfer to a paper-towel-lined plate. Serve hot with soy sauce or sweet-and-sour dipping sauce.

Tools you’ll need

  • pot with cover for steaming
  • 12-inch skillet
  • wooden spoon
  • deep heavy pot or Dutch oven
  • instant-read thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.