CookSnap is coming soon — Join the waitlist →

20-Min Curry Shrimp & Rice

Tender shrimp in a creamy coconut-curry sauce over fluffy white rice, with pickled vegetables on the side for brightness. One skillet, under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
34g
20-Min Curry Shrimp & Rice
satisfyingquickcaribbeanshrimptendercreamyweeknightbowl

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 1 can (13.5 oz) coconut milk, full-fat
  • 2 tbsp curry powder
  • 1 whole (juiced) lime
  • 1.5 cups white rice, uncooked
  • ½ cup pickled vegetables or relish
  • 2 tbsp scallions, chopped

Instructions

  1. 1

    Start rice in a pot with 3 cups water, salt, and cover. Bring to a boil, then reduce heat to low.

  2. 2

    Heat oil in a large skillet over medium-high. Add curry powder and cook for 30 seconds until fragrant.

  3. 3

    Pour in coconut milk and stir until smooth. Add shrimp and cook uncovered for 5 minutes, stirring once halfway.

  4. 4

    Squeeze lime juice over shrimp and stir. Taste and add salt and pepper to your preference.

  5. 5

    Divide rice between bowls. Top with curry shrimp and sauce, then garnish with pickled vegetables and scallions.

Tools you’ll need

  • large skillet (12-inch cast iron or non-stick)
  • medium pot with lid
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.