Crispy Tostadas with Quick Toppings
Crunchy fried tortillas topped with refried beans, cheese, and fresh salsa in under 15 minutes. A satisfying snack or light meal that comes together faster than you'd expect.
- Total time
- 12 min
- Servings
- 2
- Calories
- 385
- Protein
- 9g
casualsatisfyingmexicanvegetariancrispymeltysnackweeknight
Ingredients
- 4 tortillas corn tortillas (6-inch)
- ½ cup neutral oil
- ¾ cup refried beans
- ¾ cup shredded Oaxaca or mozzarella cheese
- ½ cup salsa (fresh or jarred)
- 1 small handful fresh cilantro or lime wedges (optional)
Instructions
- 1
Heat oil in a shallow skillet over medium-high until a tortilla sizzles immediately on contact, ~2 minutes.
- 2
Fry tortillas one at a time, 45 seconds per side, until golden and crispy. Transfer to a paper towel.
- 3
Spread 2 tablespoons warm refried beans on each tostada, pressing gently to adhere.
- 4
Divide cheese evenly among tostadas. Top with 2 tablespoons salsa each.
- 5
Serve immediately. Garnish with cilantro or serve with lime wedges if desired.
Tools you’ll need
- shallow skillet or small sauté pan (8-10 inch)
- tongs or slotted spoon
- paper towels
- knife and cutting board (for cilantro)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
