CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Tostadas with Quick Toppings

Crunchy fried tortillas topped with refried beans, cheese, and fresh salsa in under 15 minutes. A satisfying snack or light meal that comes together faster than you'd expect.

Total time
12 min
Servings
2
Calories
385
Protein
9g
Crispy Tostadas with Quick Toppings
casualsatisfyingmexicanvegetariancrispymeltysnackweeknight

Ingredients

  • 4 tortillas corn tortillas (6-inch)
  • ½ cup neutral oil
  • ¾ cup refried beans
  • ¾ cup shredded Oaxaca or mozzarella cheese
  • ½ cup salsa (fresh or jarred)
  • 1 small handful fresh cilantro or lime wedges (optional)

Instructions

  1. 1

    Heat oil in a shallow skillet over medium-high until a tortilla sizzles immediately on contact, ~2 minutes.

  2. 2

    Fry tortillas one at a time, 45 seconds per side, until golden and crispy. Transfer to a paper towel.

  3. 3

    Spread 2 tablespoons warm refried beans on each tostada, pressing gently to adhere.

  4. 4

    Divide cheese evenly among tostadas. Top with 2 tablespoons salsa each.

  5. 5

    Serve immediately. Garnish with cilantro or serve with lime wedges if desired.

Tools you’ll need

  • shallow skillet or small sauté pan (8-10 inch)
  • tongs or slotted spoon
  • paper towels
  • knife and cutting board (for cilantro)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.