Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Tempura Tendon with Rice

Golden-fried shrimp and vegetable tempura over steaming white rice, drenched in a sweet-savory dashi sauce. Pure comfort in 25 minutes — no deep fryer required.

Total time
25 min
Servings
2
Calories
420
Protein
18g
Crispy Tempura Tendon with Rice
comfortsatisfyingjapaneseshrimpcrispytenderweeknightdinner

Ingredients

  • 8 pieces large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • ½ cup cold water
  • 3 tbsp soy sauce
  • 2 tbsp mirin or honey
  • 2 cups cooked steamed white rice

Instructions

  1. 1

    Pat shrimp dry with paper towels. Mix flour and cold water in a bowl until thick, lumpy batter forms — a few flour streaks are fine.

  2. 2

    Heat 0.5 inch neutral oil in a 12-inch skillet over medium-high until a grain of flour sizzles immediately, ~3 minutes. Test with a thermometer — aim for 350°F.

  3. 3

    Dip shrimp in batter, then slide into oil. Fry 2–3 minutes per side until golden and crispy outside. Don't move them; flip only once. Transfer to a paper towel–lined plate.

  4. 4

    Pour off most oil, leaving 1 tbsp in the skillet. Add soy sauce and mirin, swirling to combine. Warm for 30 seconds until fragrant — this is your tendon sauce.

  5. 5

    Divide steamed rice between two bowls. Top each with 4 tempura shrimp and drizzle sauce over everything. Serve immediately while tempura is still crispy.

Tools you’ll need

  • 12-inch skillet with deep sides
  • instant-read thermometer
  • paper towels
  • small mixing bowl
  • slotted spoon or chopsticks
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.