CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Tasajo with Lime & Chiltepin

Sun-dried beef jerky crisped in a hot skillet with lime, garlic, and optional chiltepin for authentic Oaxacan flavor. A quick, smoky, textural dinner that tastes like street food.

Total time
25 min
Servings
2
Calories
285
Protein
32g
Crispy Tasajo with Lime & Chiltepin
rusticboldmexicanbeefcrispychewyweeknightmain-dish

Ingredients

  • ½ lb tasajo (dried beef strips)
  • 1 whole lime
  • 3 whole garlic cloves, minced
  • ½ medium white onion, sliced thin
  • ¼ tsp chiltepin or dried red chile flakes
  • 1 whole avocado (optional, for serving)
  • ¼ cup fresh cilantro (optional, chopped)

Instructions

  1. 1

    Heat 2 tablespoons oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add tasajo strips and cook without stirring until edges brown and crisp, 3–4 minutes.

  3. 3

    Flip the strips and crisp the other side another 2–3 minutes until they curl and char slightly.

  4. 4

    Push tasajo to the side; add garlic to the empty space and cook 30 seconds until fragrant.

  5. 5

    Stir in onion and chiltepin, cooking 2–3 minutes until onion softens and flavors meld.

  6. 6

    Squeeze lime juice over everything, toss gently, and serve with avocado and cilantro if desired.

Tools you’ll need

  • large 12-inch skillet
  • cutting board
  • knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.