CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Spring Rolls with Sweet Chili Dipping Sauce

Tender rice paper wraps stuffed with a savory vegetable and vermicelli filling, then fried until golden and crispy. Serve with a quick homemade sweet chili sauce for dipping.

Total time
35 min
Servings
4
Calories
312
Protein
4g
Crispy Spring Rolls with Sweet Chili Dipping Sauce
casualindulgentasianvegandairy-freecrispytenderweeknight

Ingredients

  • 16 sheets rice paper wrappers (8-inch)
  • 2 oz rice vermicelli
  • 1 cup carrots, shredded
  • 2 cups cabbage, shredded
  • ½ cup fresh mint leaves
  • 2 tbsp soy sauce
  • 3 tbsp honey
  • 2 tbsp rice vinegar
  • 3 cups neutral oil, for frying

Instructions

  1. 1

    Cook vermicelli in boiling water until just tender, ~3 minutes. Drain and cool.

  2. 2

    In a small bowl, whisk together soy sauce, rice vinegar, honey, and 3 tbsp water.

  3. 3

    Toss cooked vermicelli, carrots, cabbage, and mint in a large bowl with 1 tbsp of the sauce mixture.

  4. 4

    Fill a shallow bowl with warm water. Dip one rice paper sheet in water 2 seconds until pliable.

  5. 5

    Lay wrapper on a damp towel. Place 2 tbsp filling in the center; fold sides in, then roll tightly.

  6. 6

    Repeat with remaining wrappers and filling until all spring rolls are formed.

  7. 7

    Heat oil in a deep pot or wok to 350°F. Test with a wooden skewer—bubbles should rise steadily.

  8. 8

    Fry spring rolls in batches of 4, turning once, until deep golden, ~3 minutes total. Don't crowd.

  9. 9

    Transfer to a paper towel-lined plate. Serve hot with dipping sauce alongside.

Tools you’ll need

  • large mixing bowl
  • small mixing bowl
  • shallow dipping bowl
  • damp kitchen towel
  • deep pot or wok (3-quart minimum)
  • deep-fry or candy thermometer
  • wooden skewer or chopsticks
  • slotted spoon or spider strainer
  • paper towel-lined plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.