CookSnap is coming soon — Join the waitlist →

Crispy Skillet Chicken Quesadillas

Pan-fried flour tortillas stuffed with shredded chicken, melted cheese, and a hint of jalapeño. Golden, crispy edges with a gooey center—dinner in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
38g
Crispy Skillet Chicken Quesadillas
comfortquickmexicanchickencrispymeltyweeknightquesadilla

Ingredients

  • 1.5 cups cooked shredded chicken
  • 4 pieces flour tortillas (8-inch)
  • 1 cup sharp cheddar cheese, shredded
  • ½ piece jalapeño, diced
  • 2 tbsp butter
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Mix shredded chicken, jalapeño, and half the cheese in a bowl. Season with salt and pepper.

  2. 2

    Heat 0.5 tbsp butter in a 12-inch skillet over medium-high until it foams, ~90 seconds.

  3. 3

    Place a tortilla in the skillet. Spread 1/4 of the chicken mixture on one half.

  4. 4

    Sprinkle 1/4 of the remaining cheese over the chicken. Fold tortilla in half.

  5. 5

    Cook until the tortilla is golden and crispy, ~2 minutes. Flip and cook the other side 1-2 minutes until cheese melts and edges are golden.

  6. 6

    Transfer to a plate. Repeat with remaining tortillas, chicken, and cheese, adding butter as needed.

  7. 7

    Serve immediately while quesadillas are still crispy and cheese is melted.

Tools you’ll need

  • 12-inch nonstick or cast-iron skillet
  • cutting board
  • knife
  • mixing bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.