CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Shrimp Ukoy

Filipino-style shrimp and sweet potato fritters with a crispy exterior and tender interior. Fried golden in minutes and served with a tangy vinegar dipping sauce.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Crispy Shrimp Ukoy
satisfyingcasualfilipinoshrimpcrispytenderweeknightdinner

Ingredients

  • ½ lb shrimp, peeled and deveined
  • 1 medium sweet potato, peeled and julienned
  • ¾ cup all-purpose flour
  • 1 large egg
  • ⅓ cup white vinegar
  • 1 cup neutral oil for frying

Instructions

  1. 1

    In a bowl, whisk together flour, 1 beaten egg, 0.5 tsp salt, and 0.25 tsp black pepper.

  2. 2

    Fold shrimp and julienned sweet potato into the batter until fully coated.

  3. 3

    Heat oil in a shallow skillet over medium-high until a wooden spoon submerged sizzles immediately, ~3 minutes.

  4. 4

    Scoop batter in 2-tbsp portions into hot oil; fry 3–4 fritters at a time until golden brown, ~2 minutes per side.

  5. 5

    Transfer ukoy to a paper-towel-lined plate.

  6. 6

    Stir vinegar with 0.25 cup water and 0.5 tsp salt; serve as dipping sauce alongside fritters.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • shallow skillet or frying pan
  • wooden spoon
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.