CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Shrimp Soba

Tender soba noodles in a hot dashi broth, topped with crispy panko shrimp and a soft egg. Dinner in under 10 minutes.

Total time
10 min
Servings
2
Calories
412
Protein
32g
Crispy Shrimp Soba
quickcomfortjapaneseshrimpcrispytendersilkyweeknight

Ingredients

  • 6 oz soba noodles
  • 10 oz large shrimp, peeled and deveined
  • ½ cup panko breadcrumbs
  • 3 cups dashi broth (or instant dashi mixed with water)
  • 2 tbsp soy sauce
  • 2 whole large eggs
  • 1 stalk scallion, thinly sliced

Instructions

  1. 1

    Bring dashi and soy sauce to a simmer in a large pot over medium-high heat.

  2. 2

    Pat shrimp dry. Toss with salt, pepper, then coat in panko. Heat oil in a skillet over medium-high until shimmering.

  3. 3

    Sear panko shrimp 90 seconds per side until edges turn golden. Transfer to a plate.

  4. 4

    Add soba to the simmering broth, stir gently, and boil 3–4 minutes until tender.

  5. 5

    Crack both eggs into the broth at opposite ends. Let whites set but yolks stay runny, about 2 minutes.

  6. 6

    Pour noodles and broth into two bowls. Top each with shrimp, one egg, and scallion. Serve hot.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • tongs
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.