CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Sambusa with Chili Sauce

Golden fried pastry triangles stuffed with spiced ground meat, served with fiery chili sauce and fresh cilantro. A weeknight-friendly take on the Ethiopian classic — no phyllo folding required.

Total time
28 min
Servings
2
Calories
420
Protein
18g
Crispy Sambusa with Chili Sauce
comfortcasualethiopianbeefcrispytenderweeknightdinner

Ingredients

  • ½ lb ground beef
  • ½ medium yellow onion, finely diced
  • 12 count wonton wrappers
  • 1 tbsp ginger-garlic paste
  • 1 tsp chili powder
  • 2 tbsp tomato paste
  • ¼ cup fresh cilantro, chopped
  • 2 cups neutral cooking oil

Instructions

  1. 1

    Brown ground beef in a skillet over medium-high, breaking it apart with a spoon until no pink remains, about 5 minutes.

  2. 2

    Add diced onion and ginger-garlic paste, cooking for 1 minute until fragrant, then stir in chili powder and tomato paste.

  3. 3

    Cook the filling for 2 minutes, then remove from heat and stir in half the cilantro. Season with salt and pepper.

  4. 4

    Spoon 1 tbsp filling into the center of each wonton wrapper, fold into a triangle, and press edges to seal.

  5. 5

    Heat oil in a heavy pot to 350°F (use a thermometer). Fry sambusat 2–3 per batch until golden brown, about 90 seconds per side.

  6. 6

    Drain on paper towels and serve hot with chili sauce, remaining cilantro, and fresh sliced red chilies on the side.

Tools you’ll need

  • 12-inch skillet
  • heavy-bottomed pot
  • deep-fry or candy thermometer
  • wooden spoon
  • paper towels
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.