CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Saltfish & Ackee

Salty, flaky saltfish paired with buttery, tender ackee in a 20-minute Caribbean dinner. Toast onions and peppers, warm the ackee gently, and serve with crusty bread.

Total time
20 min
Servings
2
Calories
285
Protein
22g
Crispy Saltfish & Ackee
wholesomesimplecaribbeanfishflakytendercrispyweeknight

Ingredients

  • 8 oz canned saltfish, drained and flaked
  • 15 oz canned ackee, drained gently
  • ½ medium yellow onion, sliced thin
  • 1 medium red bell pepper, sliced into strips
  • ½ small scotch bonnet or habanero pepper, minced
  • 3 sprigs fresh thyme sprigs (or 1 tsp dried)
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat oil in a large skillet over medium-high. Add onion and bell pepper, cook until edges char and soften, ~5 minutes.

  2. 2

    Stir in the minced hot pepper and thyme. Cook until fragrant, about 60 seconds.

  3. 3

    Add flaked saltfish and toss gently to combine, warming through, ~2 minutes.

  4. 4

    Fold in the ackee with a gentle hand—it breaks apart easily. Warm for 1 minute without stirring.

  5. 5

    Taste and season with salt and pepper. Serve hot with crusty bread or boiled green bananas.

Tools you’ll need

  • large skillet (10–12 inch)
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.